The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the C-terminal domain of human Activator of 90 kDa heat shock protein ATPase homolog 1. To be Published
    Site RSGI
    PDB Id 1x53 Target Id hss001000725.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13215, Molecular Weight 15165.46 Da.
    Residues 132 Isoelectric Point 5.58
    Sequence iptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgnvsgeftdlvpekhivm kwrfkswpeghfatitltfidkngetelcmegrgipapeeertrqgwqryyfegikqtfgyga
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch