.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis of the Water-assisted Asparagine Recognition by Asparaginyl-tRNA Synthetase. J.Mol.Biol. 360 329-342 2006
    Site RSGI
    PDB Id 1x54 Target Id pho001000241.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13805, Molecular Weight 50157.09 Da.
    Residues 434 Isoelectric Point 5.40
    Sequence miekvycqevkpeldgkkvrlagwvytnmrvgkkiflwirdstgivqavvaknvvgeetfekakklgre ssvivegivkaderapggaevhvekleviqavsefpipenpeqaspellldyrhlhirtpkasaimkvk etlimaarewllkdgwhevfppilvtgaveggatlfklkyfdkyaylsqsaqlyleaaifglekvwslt psfraeksrtrrhltefwhleleaawmdlwdimkveeelvsymvqrtlelrkkeiemfrddlttlknte ppfprisydeaidilqskgvnvewgddlgadeervlteefdrpffvygypkhikafymkedpndprkvl asdmlapegygeiiggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfglgverlvawvl kldhirwaalfprtparlyp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.19157
    Matthews' coefficent 2.90 Rfactor 0.16783
    Waters 309 Solvent Content 57.10

    Ligand Information
    Ligands 4AD (4-AMINO-1,4-DIOXOBUTAN-2-AMINIUM) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch