The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the HTH domain of human EDF-1 protein. To be Published
    Site RSGI
    PDB Id 1x57 Target Id hsi002010852.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12439, Molecular Weight 8559.52 Da.
    Residues 78 Isoelectric Point 10.14
    Sequence drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraiglklrgkdigk piekgprak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch