.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x58

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the myb-like DNA binding domain of 4930532D21Rik protein. To be Published
    Site RSGI
    PDB Id 1x58 Target Id mmt008001488.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13657, Molecular Weight 5972.62 Da.
    Residues 49 Isoelectric Point 10.11
    Sequence rkdftkeevnylfhgvktmgnhwnsilwsfpfqkgrravdlahkyhrli
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch