The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the C-terminal LIM domain of human FHL5 protein. To be Published
    Site RSGI
    PDB Id 1x68 Target Id hsi002011630.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12454, Molecular Weight 6787.48 Da.
    Residues 63 Isoelectric Point 7.70
    Sequence cvacskpisgltgakficfqdsqwhsecfncgkcsvslvgkgfltqnkeifcqkcgsgmdtdi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch