.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xkv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8 showing the structural basis of induced fit and thermostability. Acta Crystallogr.,Sect.D 61 1500-1507 2005
    Site RSGI
    PDB Id 1xkv Target Id ttk003000460.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14370, Molecular Weight 59311.39 Da.
    Residues 529 Isoelectric Point 6.28
    Sequence mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvrepevegei wwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvtespwhalfarnmfilprr fgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvlivgtkyageikksiftvmnylm pkrgvfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcyakvirl spehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvvesgvaghpraiffl sadaygvlppiarlspeeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgeki rkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqell npretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.219
    Matthews' coefficent 3.11 Rfactor 0.186
    Waters 738 Solvent Content 60.48

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1;GOL (GLYCEROL) x 2
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch