The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a flavoenzyme TTHA0420 from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 1yoa Target Id ttk003001382.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14713, Molecular Weight 17726.42 Da.
    Residues 159 Isoelectric Point 6.06
    Sequence mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalvertgklalm tlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaevrhlypggdhslvvaevve agvrreekplvmwdtgwfygg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.22761
    Matthews' coefficent 2.70 Rfactor 0.19989
    Waters 67 Solvent Content 54.40

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1;FMN (FLAVIN) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch