The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0473, putative Triosephosphate Isomerase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1yya Target Id ttk003000473.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14377, Molecular Weight 27093.64 Da.
    Residues 250 Isoelectric Point 6.03
    Sequence mrrvlvagnwkmhktpsearvwfaelkrllpplqseaavlpafpilpvakevlaetqvgygaqdvsahk egaytgevsarmlsdlgcryaivghserrryhgetdalvaekakrlleegitpilcvgeplevrekgea vpytlrqlrgslegveppgpealviayepvwaigtgknatpedaeamhqairkalserygeafasrvri lyggsvnpknfadllsmpnvdgglvggaslelesflallriag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.182
    Matthews' coefficent 2.90 Rfactor 0.174
    Waters 751 Solvent Content 57.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 7
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch