The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus. TO BE PUBLISHED
    Site RSGI
    PDB Id 1z54 Target Id ttk003001821.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14804, Molecular Weight 13248.70 Da.
    Residues 116 Isoelectric Point 9.42
    Sequence mgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelgltfraparfgevvevrtrlaelssr allfryrveregvllaegftrhlcqvgeraaripediyralsvlhlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.251
    Matthews' coefficent 2.10 Rfactor 0.203
    Waters 422 Solvent Content 40.90

    Ligand Information
    Ligands GOL (GLYCEROL) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch