.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zjj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1zjj Target Id pho001001952.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14024, Molecular Weight 29061.41 Da.
    Residues 263 Isoelectric Point 5.30
    Sequence mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgidvsssiiits glatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevkhvvvgldpdltyeklkya tlairngatfigtnpdatlpgeegiypgagsiiaalkvatnvepiiigkpnepmyevvremfpgeelwm vgdrldtdiafakkfgmkaimvltgvssledikkseykpdlvlpsvyelidylktl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.221
    Matthews' coefficent 2.10 Rfactor 0.195
    Waters 514 Solvent Content 41.30

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch