The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of transcription inhibition by antibiotic streptolydigin. Mol.Cell 19 655-666 2005
    Site RSGI
    PDB Id 2a6h Target Id ttk003000780.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14431, Molecular Weight 125257.82 Da.
    Residues 1119 Isoelectric Point 5.71
    Sequence meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkgkgglvldfl eyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsfiingadrvivs qihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvnkrkfplvlllrvlgydqetl arelgaygelvqglmdesvfamrpeealirlftllrpgdppkrdkavayvygliadprrydlgeagryk aeeklgirlsgrtlarfedgefkdevflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfr vglarlargvrermlmgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalg pggltreragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdev vymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnlipfleh ddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvdgnrivvryedgrlv eyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengflalgqnvlvaimpfdgynfedaivi seellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegvvrigaevkpgdilvgrt sfkgeseptpeerllrsifgekardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyva qkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyfl gqryispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqfggqrfgem evwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.268
    Matthews' coefficent 5.20 Rfactor 0.23
    Waters 7398 Solvent Content 75.00

    Ligand Information
    Ligands STD (STREPTOLYDIGIN) x 2
    Metals MG (MAGNESIUM) x 2;ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch