.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bhp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermus Thermophilus Delta(1)- Pyrroline-5-Carboxylate Dehydrogenase. J.Mol.Biol. 362 490 2006
    Site RSGI
    PDB Id 2bhp Target Id ttk003000033.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14187, Molecular Weight 57043.17 Da.
    Residues 516 Isoelectric Point 5.57
    Sequence mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsapsevvgtta kagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatlvyevgknwveasadvaea idfieyyaraalryrypavevvpypgednesfyvplgagvviapwnfpvaiftgmivgpvavgntviak paedavvvgakvfeifheagfppgvvnflpgvgeevgaylvehprirfinftgslevglkiyeaagrla pgqtwfkrayvetggkdaiivdetadfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkr aerlsvgpaeenpdlgpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkaria qeeifgpvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalvgvq pfggfklsgtnaktgaldylrlflemkavaerf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.8 Rfree 0.176
    Matthews' coefficent 2.5 Rfactor 0.148
    Waters 1200 Solvent Content 50

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;ACT (ACETATE) x 5;MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 6;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 4
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch