.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bj3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition. J.Mol.Biol. 348 597 2005
    Site RSGI
    PDB Id 2bj3 Target Id pho001000601.4
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13841, Molecular Weight 15805.49 Da.
    Residues 138 Isoelectric Point 5.22
    Sequence melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtitivynhdegdv vkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllslkgvkhgklvmtstgkelv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.268
    Matthews' coefficent Rfactor 0.218
    Waters 103 Solvent Content

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2;MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch