.
The Open Protein Structure Annotation Network
PDB Keyword
.

2blc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Dihydrofolate Reductase from Plasmodium Vivax: Pyrimethamine Displacement Linked with Mutation-Induced Resistance. Proc.Natl.Acad.Sci.USA 102 13046 2005
    Site RSGI
    PDB Id 2blc Target Id ar_001000501.3
    Molecular Characteristics
    Source Plasmodium vivax
    Alias Ids TPS12171, Molecular Weight 26662.19 Da.
    Residues 232 Isoelectric Point 8.82
    Sequence medlsdvfdiyaicacckvaptsegtknepfsprtfrglgnkgtlpwkcnsvdmkyfrsvttyvdesky eklkwkrerylrmeasqgggdntsggdnnadklqnvvvmgrsnwesipkqykplpnrinvvlsktltke dvkekvfiidsiddlllllkklkyykcfiiggaqvyreclsrnlikqiyftringaypcdvffpefdes qfrvtsvsevynskgttldflvysk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.280
    Matthews' coefficent 2.81 Rfactor 0.215
    Waters 209 Solvent Content 55.96

    Ligand Information
    Ligands NDP (NADPH) x 1;CP7 (6-ETHYL-5-PHENYLPYRIMIDINE-2,4-DIAMINE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch