.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cb1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of O-Acetyl Homoserine Sulfhydrylase. To be Published
    Site RSGI
    PDB Id 2cb1 Target Id ttk003000073.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14214, Molecular Weight 44181.47 Da.
    Residues 412 Isoelectric Point 5.78
    Sequence meyttlavlaglpedphgavglpiyavaaygfktleegqerfatgegyvyarqkdptakaleerlkale galeavvlasgqaatfaallallrpgdevvaakglfgqtiglfgqvlslmgvtvryvdpepeavreals aktravfvetvanpallvpdlealatlaeeagvalvvdntfgaagalcrplawgahvvvesltkwasgh gsvlggavlsretelwrnypqflqpdlkgqipwealrarcfpervrtlglslcgmalspfnayllfqgl etvalrvarmsetarflaerlqghpkvkalrypglpedpahrnarkylasggpiltldlgdlerasrfl gairllkaanlgdartllvhpwttthsrlkeearlqagvtpglvrvsvgledpldllalfeealeav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.0 Rfree 0.234
    Matthews' coefficent Rfactor 0.187
    Waters 147 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch