.
The Open Protein Structure Annotation Network
PDB Keyword
.

2co8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the LIM domain of human NEDD9 interacting protein with calponin homology and LIM domains. To be Published
    Site RSGI
    PDB Id 2co8 Target Id hss001000142.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13182, Molecular Weight 7841.37 Da.
    Residues 69 Isoelectric Point 5.82
    Sequence qhqeagagdlcalcgehlyvlerlcvnghffhrscfrchtceatlwpggyeqhpgdghfyclqhlpqtd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch