.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cof

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C-terminal PH domain of hypothetical protein KIAA1914 from human. To be Published
    Site RSGI
    PDB Id 2cof Target Id hsi002010814.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12436, Molecular Weight 10778.59 Da.
    Residues 94 Isoelectric Point 6.20
    Sequence letssylnvlvnsqwksrwcsvrdnhlhfyqdrnrskvaqqplslvgcevvpdpspdhlysfrilhkge elakleaksseemghwlglllsesg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch