The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin. To be Published
    Site RSGI
    PDB Id 2cp5 Target Id hso002001267.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12972, Molecular Weight 13838.18 Da.
    Residues 128 Isoelectric Point 9.34
    Sequence msmlkpsglkaptkilkpgstalktptavvapvektissekasstpssetqeefvddfrvgervwvngn kpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgiftrpskltrkv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch