.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cp8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant. To be Published
    Site RSGI
    PDB Id 2cp8 Target Id hsk002100046.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12694, Molecular Weight 4827.51 Da.
    Residues 41 Isoelectric Point 8.19
    Sequence qtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellql
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch