The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the penultimate RNA recognition motif of hypothetical RNA-binding protein RBM19. To be Published
    Site RSGI
    PDB Id 2cpf Target Id mmt007011210.12
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13532, Molecular Weight 9378.53 Da.
    Residues 85 Isoelectric Point 9.95
    Sequence lfiknlnfstteetlkgvfskvgaiksctiskkknkagvllsmgfgfveykkpeqaqkalkqlqghtvd ghklevriseratkpa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch