The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA recognition motif of CNOT4. To be Published
    Site RSGI
    PDB Id 2cpi Target Id mmt008001487.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13656, Molecular Weight 10699.72 Da.
    Residues 98 Isoelectric Point 9.70
    Sequence asvrvvqknlvfvvglsqrladpevlkrpeyfgkfgkihkvvinnstsyagsqgpsasayvtyirseda lraiqcvnnvvvdgrtlkaslgttkycsy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch