The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title solution structure of RNA binding domain in Hypothetical protein FLJ11016. To be Published
    Site RSGI
    PDB Id 2cpx Target Id hsi002007170.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12419, Molecular Weight 11960.51 Da.
    Residues 102 Isoelectric Point 10.28
    Sequence eeirkipmfssynpgepnkvlylknlsprvterdlvslfarfqekkgppiqfrmmtgrmrgqafitfpn keiawqalhlvngyklygkilviefgknkkqrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch