.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cqj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the S4 domain of U3 small nucleolar ribonucleoprotein protein IMP3 homolog. To be Published
    Site RSGI
    PDB Id 2cqj Target Id hss001002801.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13307, Molecular Weight 6532.31 Da.
    Residues 58 Isoelectric Point 8.60
    Sequence rrlptvllklrmaqhlqaavafveqghvrvgpdvvtdpaflvtrsmedfvtwvdsski
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch