The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal domain of human ribosomal protein L9. To be Published
    Site RSGI
    PDB Id 2cql Target Id hss001000008.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13174, Molecular Weight 9934.27 Da.
    Residues 87 Isoelectric Point 10.78
    Sequence mktilsnqtvdipenvditlkgrtvivkgprgtlrrdfnhinvelsllgkkkkrlrvdkwwgnrkelat vrticshvqnmikgvtlg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch