The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of nuclear move domain of nuclear distribution gene C. To be Published
    Site RSGI
    PDB Id 2cr0 Target Id mmt007103799.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13596, Molecular Weight 12433.66 Da.
    Residues 108 Isoelectric Point 6.95
    Sequence kpnlgngadlpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgelynevkv eesswliedgkvvtvhlekinkmewwnrlvtsdpeintk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch