.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cr3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first Ig-like domain of human fibroblast growth factor receptor 1. To be Published
    Site RSGI
    PDB Id 2cr3 Target Id hsi002021425.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12531, Molecular Weight 9411.83 Da.
    Residues 86 Isoelectric Point 4.24
    Sequence vevesflvhpgdllqlrcrlrddvqsinwlrdgvqlaesnrtritgeevevqdsvpadsglyacvtssp sgsdttyfsvnvsdalp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch