.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH2 domain of human SH3BP2 protein. To be Published
    Site RSGI
    PDB Id 2cr4 Target Id hss001002513.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13296, Molecular Weight 13042.04 Da.
    Residues 113 Isoelectric Point 6.22
    Sequence edyekvplpnsvfvnttesceverlfkatsprgepqdglycirnsstksgkvlvvwdetsnkvrnyrif ekdskfylegevlfvsvgsmvehyhthvlpshqslllrhpygyt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch