.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B. to be published
    Site RSGI
    PDB Id 2cr7 Target Id mmi002020352.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13413, Molecular Weight 7648.33 Da.
    Residues 67 Isoelectric Point 5.40
    Sequence vhvedaltyldqvkirfgsdpatyngfleimkefksqsidtpgvirrvsqlfhehpdlivgfnaflp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch