The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of C-terminal domain of RIKEN cDNA 2810012L14. To be published
    Site RSGI
    PDB Id 2crq Target Id mmt007014722.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13554, Molecular Weight 11449.50 Da.
    Residues 99 Isoelectric Point 9.14
    Sequence pktgptmtkelvfssnigqhdldtkskqiqqwiekkyhvqvtikrrkdaeqseeeteeifnqilqtmpd iatfssrpkairggtasmcvfrhlskkeek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch