The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of tandem repeat of the fifth and sixth zinc-finger C2HC domains from human ST18. To be Published
    Site RSGI
    PDB Id 2cs8 Target Id hsk002100521.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12715, Molecular Weight 10080.12 Da.
    Residues 95 Isoelectric Point 9.51
    Sequence pelkcpvigcdgqghisgkytshrtasgcplaakrqkenplngaslswklnkqelphcplpgcnglghv nnvfvthrslsgcplnaqvikkgkvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch