The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B. To be Published
    Site RSGI
    PDB Id 2csh Target Id hsk002000403
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12588, Molecular Weight 11271.59 Da.
    Residues 97 Isoelectric Point 9.58
    Sequence dklypcqcgksfthksqrdrhmsmhlglrpygcgvcgkkfkmkhhlvghmkihtgikpyecnicakrfm wrdsfhrhvtsctksyeaakaeqnttea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch