The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0137 from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2csl Target Id ttk003000865.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14462, Molecular Weight 13144.41 Da.
    Residues 124 Isoelectric Point 5.18
    Sequence meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavleaagsglsr vvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacvalae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.267
    Matthews' coefficent 4.40 Rfactor 0.224
    Waters 159 Solvent Content 72.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch