.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0766 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2csu Target Id pho001000766.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13943, Molecular Weight 49722.06 Da.
    Residues 457 Isoelectric Point 6.54
    Sequence mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkdipdeidlai ivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahkygmriigpncvgimnthvd lnatfitvakkgnvafisqsgalgagivyktikedigfskfisvgnmadvdfaelmeyladteedkaia lyiegvrngkkfmevakrvtkkkpiialkagksesgaraasshtgslagswkiyeaafkqsgvlvanti demlsmarafsqplprgnkvaimtnaggpgvltadeldkrglklatleektieelrsflppmaavknpv dmiasargedyyrtaklllqdpnvdmliaicvvptfagmtltehaegiiravkevnnekpvlamfmagy vsekakellekngiptyerpedvasaayalveqaknvgileve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.261
    Matthews' coefficent 2.30 Rfactor 0.246
    Waters 460 Solvent Content 45.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch