.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for anticodon recognition by methionyl-tRNA synthetase. Nat.Struct.Mol.Biol. 12 931-932 2005
    Site RSGI
    PDB Id 2csx Target Id aae001001257.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12061, Molecular Weight 58927.96 Da.
    Residues 497 Isoelectric Point 7.18
    Sequence mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqkkaeelgisp kelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiylgeyegwycvgceefkse aelaedhtcpihqkkceyikepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvt rprsrvkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpaflmslg yelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnring elaneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeilkftsylnk yvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqmlgekeflkelkpysknty klgerkilfpkreg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.302
    Matthews' coefficent 2.48 Rfactor 0.239
    Waters 42 Solvent Content 50.35

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch