The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of two zf-C2H2 domains from human Zinc finger protein 512. To be Published
    Site RSGI
    PDB Id 2ctd Target Id hsk002001773.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12682, Molecular Weight 9429.51 Da.
    Residues 83 Isoelectric Point 8.90
    Sequence rirkeppvyaagsleeqwyleivdkgsvscptcqavgrktieglkkhmenckqemftchhcgkqlrsla gmkyhvmanhnslp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch