The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of J-domain from human DnaJ subfamily C menber 12. To be Published
    Site RSGI
    PDB Id 2ctq Target Id hss001000599.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13208, Molecular Weight 11722.50 Da.
    Residues 99 Isoelectric Point 5.01
    Sequence mdailnyrsedtedyytllgcdelssveqilaefkvralechpdkhpenpkavetfqklqkakeiltne esrarydhwrrsqmsmpfqqwealndsvkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch