.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ctt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of zinc finger domain from human DnaJ subfamily A menber 3. To be Published
    Site RSGI
    PDB Id 2ctt Target Id hss001002559.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13297, Molecular Weight 9841.90 Da.
    Residues 91 Isoelectric Point 9.35
    Sequence meltfnqaakgvnkeftvnimdtcercngkgnepgtkvqhchycggsgmetintgpfvmrstcrrcggr gsiiispcvvcrgagqakqkkr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch