The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of o-acetyl homoserine sulfhydrylase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ctz Target Id ttk003000071.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14213, Molecular Weight 46085.19 Da.
    Residues 421 Isoelectric Point 6.50
    Sequence mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptvdvlekrlaa leggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkrlgievrftsreerpeefl altdektrawwvesignpalnipdlealaqaarekgvalivdntfgmggyllrplawgaalvthsltkw vgghgaviagaivdggnfpweggryplltepqpgyhglrlteafgelafivkarvdglrdqgqalgpfe awvvllgmetlslraerhventlhlahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglk ggyeaakrfisrlklishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlka elkeala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.21716
    Matthews' coefficent 6.60 Rfactor 0.18706
    Waters 174 Solvent Content 81.36

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch