.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cu0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of inosine-5'-monophosphate dehydrogenase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2cu0 Target Id pho001000307.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13810, Molecular Weight 52929.84 Da.
    Residues 486 Isoelectric Point 5.85
    Sequence mgkfveklekaikgytfddvllipqatevepkdvdvstritpnvklnipilsaamdtvtewemavamar egglgvihrnmgieeqveqvkrvkraerlivedvitiapdetvdfalflmekhgidglpvvedekvvgi itkkdiaaregklvkelmtkevitvpesieveealkimienridrlpvvdergklvglitmsdlvarkk yknavrdengellvaaavspfdikraieldkagvdvivvdtahahnlkaiksmkemrqkvdadfivgni anpkavddltfadavkvgigpgsicttrivagvgvpqitavamvadraqeyglyviadggirysgdivk aiaagadavmlgnllagtkeapgkeviingrkykqyrgmgslgammkggaeryyqggymktrkfvpegv egvvpyrgtvsevlyqlvgglkagmgyvgarnirelkekgefviithagikeshphdiiitneapnyplekf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.228
    Matthews' coefficent 2.34 Rfactor 0.205
    Waters 374 Solvent Content 47.53

    Ligand Information
    Ligands XMP (XANTHOSINE-5'-MONOPHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch