The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mannose-1-phosphate guanyltransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cu2 Target Id ttk003001092.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14520, Molecular Weight 37436.94 Da.
    Residues 337 Isoelectric Point 5.35
    Sequence mktyalvmaggrgerlwplsredrpkpflplfegktlleatlerlaplvppertllavrrdqeavarpy adgirllleplgrdtagavllgvaealkegaerllvlpadhyvgddeayrealatmleaaeegfvvalg lrptrpeteygyirlgpregawyrgegfvekpsyaealeyirkgyvwnggvfafapatmaelfrrhlps hhealerllagasleevyaglpkisidygvmekaervrvvlgrfpwddvgnwralervfsqdphenvvl gegrhvaldtfgcvvyadrgvvatlgvsglvvakvgdevlvvpkdwarevrevvkrleaqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.253
    Matthews' coefficent 3.10 Rfactor 0.219
    Waters 233 Solvent Content 59.70

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch