.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cu5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of The Conserved Hypothetical Protein TT1486 From Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cu5 Target Id ttk003001486.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14734, Molecular Weight 14408.92 Da.
    Residues 129 Isoelectric Point 7.07
    Sequence megvvrlevptpeegfvnitrkveaalsghtglvylfvphttcgltvqegadptvaqdllgrlaelapr hrpqdrhlegnshahlkslltgvhllllaekgrlrlgrwqqvflaefdgprvrevwvrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.84 Rfree 0.239
    Matthews' coefficent 1.85 Rfactor 0.199
    Waters 224 Solvent Content 32.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch