.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cub

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of the human cytoplasmic protein Nck1. To be Published
    Site RSGI
    PDB Id 2cub Target Id hss001002947.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13310, Molecular Weight 8549.09 Da.
    Residues 75 Isoelectric Point 4.49
    Sequence dpgerlydlnmpayvkfnymaeredelslikgtkvivmekcsdgwwrgsyngqvgwfpsnyvteegdsp lgdhvg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch