The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the J domain of the pseudo DnaJ protein, mouse hypothetical mKIAA0962. To be Published
    Site RSGI
    PDB Id 2cug Target Id mmt008000663.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13631, Molecular Weight 8700.26 Da.
    Residues 75 Isoelectric Point 8.17
    Sequence ilqslsaldfdpyrvlgvsrtasqadikkaykklarewhpdknkdpgaedrfiqiskayeilsneekrt nydhyg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch