.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cuk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0316 protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cuk Target Id ttk003000316.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14331, Molecular Weight 33820.65 Da.
    Residues 311 Isoelectric Point 7.95
    Sequence mrvlvtrtlpgkaldrlrerglevevhrglflpkaellkrvegavgliptvedridaevmdrakglkvi acysvgvdhvdleaarergirvthtpgvlteatadltlalllavarrvvegaayardglwkawhpelll gldlqgltlglvgmgrigqavakralafgmrvvyhartpkplpypflsleellkeadvvslhtpltpet hrllnrerlfamkrgaillntargalvdtealvealrghlfgagldvtdpeplppghplyalpnavitp higsagrttrermaevavenllavlegreppnpvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.20 Rfactor 0.185
    Waters 998 Solvent Content 42.50

    Ligand Information
    Ligands NHE (2-[N-CYCLOHEXYLAMINO]ETHANE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch