The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermus thermophilus PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway. To be Published
    Site RSGI
    PDB Id 2cuw Target Id ttk003001807.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14795, Molecular Weight 9204.39 Da.
    Residues 84 Isoelectric Point 4.96
    Sequence mpryqatllielkkgildpqgravegvlkdlghpveevrvgkvleivfpaenlleaeekakamgallan pvmevyalealkelp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.275
    Matthews' coefficent 2.60 Rfactor 0.231
    Waters 35 Solvent Content 51.40

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch