.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tRNA-intron endonuclease from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2cv8 Target Id sto001000358.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14034, Molecular Weight 20505.97 Da.
    Residues 180 Isoelectric Point 9.22
    Sequence migelvkdkilikniedarliykmgyygkpigiskpksaeeinselilsliegvylvkkgkleivsnge rldferlyqigvtqiprfrilysvyedlrekgyvvrsgikygadfavytigpgiehapylvialdensq issneilgfgrvshstrkelilgivnltngkiryimfkwlkm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.299
    Matthews' coefficent 2.20 Rfactor 0.226
    Waters 26 Solvent Content 43.20

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch