.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cv9 Target Id ttk003001657.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14764, Molecular Weight 27985.46 Da.
    Residues 252 Isoelectric Point 5.73
    Sequence mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdlvslgnhawd hkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdplddpfraldrlleeekad yvlvevhaeatsekmalahyldgrasavlgththvptldatrlpkgtlyqtdvgmtgtyhsiiggevet flarfltgrpqpfraaqgkarfhatelvfeggrpvaispyvweep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.247
    Matthews' coefficent 2.50 Rfactor 0.197
    Waters 430 Solvent Content 51.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch