.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cvb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a thioredoxin-like protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cvb Target Id ttk003001681.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14775, Molecular Weight 21361.21 Da.
    Residues 188 Isoelectric Point 5.22
    Sequence mlqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalaeryrgkvafv ginandyekypedapekmaafaeehgiffpylldetqevakayralrtpevflfderrllryhgrvndn pkdpskvqshdleaaieallrgeepplkeapaigctikwrpgnepevrig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.227
    Matthews' coefficent 3.10 Rfactor 0.212
    Waters 119 Solvent Content 59.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch