.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cvk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Reduced Thioredoxin from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cvk Target Id ttk003000408.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14363, Molecular Weight 12460.92 Da.
    Residues 110 Isoelectric Point 5.36
    Sequence makpievtdqnfdetlgqhplvlvdfwaewcapcrmiapileeiakeyegkllvakldvdenpktamry rvmsiptvilfkdgqpvevlvgaqpkrnyqakiekhlpata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.263
    Matthews' coefficent 2.04 Rfactor 0.232
    Waters 43 Solvent Content 39.59

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch