.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cw5 Target Id ttk003001469.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14730, Molecular Weight 26944.70 Da.
    Residues 255 Isoelectric Point 5.99
    Sequence mrpvyflsdfgledpyvavvkavlaerapgpavvdlahalppqdlrraayalfealpylpegavvlavv dpgvgtarravaalgrwtyvgpdnglftlawlldpprrafllepprprpkaalpgwapgeatfhgrdvf apaaahlalglppeglgpevpvetlarlplaltegpegevltfdrfgnaittllrapvggfvevggrrv pvrrtfgevpegapvaylgsagllevavnrgsarealglkegmpvrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.246
    Matthews' coefficent 2.20 Rfactor 0.212
    Waters 227 Solvent Content 43.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch